PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 348aa    MW: 39613 Da    PI: 6.8256
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589329.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
   XP_009589329.1 13 RGLWSPEEDEKLIRHITSHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding52.31.3e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
   XP_009589329.1  66 RGSFTEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-26463IPR009057Homeodomain-like
PROSITE profilePS5129418.392860IPR017930Myb domain
SuperFamilySSF466897.7E-2910107IPR009057Homeodomain-like
SMARTSM007175.2E-131262IPR001005SANT/Myb domain
PfamPF002493.2E-151360IPR001005SANT/Myb domain
CDDcd001672.30E-111660No hitNo description
PROSITE profilePS5129425.80861115IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2564116IPR009057Homeodomain-like
SMARTSM007171.5E-1565113IPR001005SANT/Myb domain
PfamPF002492.7E-1566109IPR001005SANT/Myb domain
CDDcd001671.52E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLIRHITS HGHGCWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDVRRGSFT EQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPNTHNLLKN KTNNSTKAKT NYHQDSTSVF TIDTSTNKEV ISMDIKAALA SFSPFPHGSN  180
TTTCNTYNYT PIVPNIEYQN PTFTWSGQRN QTATTTSQSQ SSDRNHIITQ NSMLDFASSS  240
LMESSTNIRQ GETEYINENS MWHGTGIEPT TLNPANGPEE LMQVQQGEQF PIQTKFCDQE  300
DVYKVNHDQT VENTFDSSNF DFDFVDSTLM PCGLYTNVNS MDQLSWDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-109HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589329.10.0PREDICTED: transcription factor MYB86-like isoform X1
TrEMBLK4CX571e-177K4CX57_SOLLC; Uncharacterized protein
STRINGSolyc10g005240.2.11e-177(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.15e-79myb domain protein 67